Lineage for d2hoig1 (2hoi G:20-129)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771322Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 771323Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 771324Protein Cre recombinase [47825] (1 species)
  7. 771325Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 771333Domain d2hoig1: 2hoi G:20-129 [147321]
    Other proteins in same PDB: d2hoia2, d2hoib2, d2hoig2, d2hoih2
    automatically matched to d1nzba1
    mutant

Details for d2hoig1

PDB Entry: 2hoi (more details), 2.6 Å

PDB Description: crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination
PDB Compounds: (G:) Recombinase cre

SCOP Domain Sequences for d2hoig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoig1 a.60.9.1 (G:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d2hoig1:

Click to download the PDB-style file with coordinates for d2hoig1.
(The format of our PDB-style files is described here.)

Timeline for d2hoig1: