SCOP 1.75: Domain d2hoia2: 2hoi A:130-341

Lineage for d2hoia2 (2hoi A:130-341)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d2hoia2: 2hoi A:130-341 [147318]
   Other proteins in same PDB: d2hoia1, d2hoib1, d2hoig1, d2hoih1
   automatically matched to d1crxa2
   mutant

Details for d2hoia2

PDB Entry: 2hoi, 2.6 Å

PDB Description: crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination

PDB Compounds: (A:) Recombinase cre

SCOP Domain Sequences for d2hoia2:

Sequence; same for both SEQRES and ATOM records:

>d2hoia2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d2hoia2:

• d2hoia2 is new in SCOP 1.75
  
• d2hoia2 appears in SCOPe 2.01
  
• d2hoia2 appears in the current release, SCOPe 2.08