SCOPe 2.08: Domain d2hnga1: 2hng A:5-128

Lineage for d2hnga1 (2hng A:5-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.33: SecB-like [54610] (1 superfamily)
   beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432

4. Superfamily d.33.1: SecB-like [54611] (3 families)

5. Family d.33.1.2: SP1558-like [160154] (2 proteins)
   Pfam PF06619; DUF1149

6. Protein Hypothetical protein SP1558 [160155] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160156] (1 PDB entry)
   Uniprot Q97PP5 5-128

8. Domain d2hnga1: 2hng A:5-128 [147311]
   Other proteins in same PDB: d2hnga2

Details for d2hnga1

PDB Entry: 2hng, 1.63 Å

PDB Description: The Crystal Structure of Protein of Unknown Function SP1558 from Streptococcus pneumoniae

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hnga1:

Sequence; same for both SEQRES and ATOM records:

>d2hnga1 d.33.1.2 (A:5-128) Hypothetical protein SP1558 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mnlkreqefvsqyhfdarnfewenengapetkvdvnfqllqhdqenqvtslivilsfmiv
fdkfvisgtisqvnhidgrivnepselnqeevetlarpclnmlnrltyevteialdlpgi
nlef

Timeline for d2hnga1:

• d2hnga1 first appeared in SCOP 1.75
  
• d2hnga1 appears in SCOPe 2.07