Lineage for d2hl9a_ (2hl9 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889579Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1889612Protein Ulp1 protease C-terminal domain [54057] (1 species)
  7. 1889613Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)
  8. 1889615Domain d2hl9a_: 2hl9 A: [147308]
    automated match to d1euva_

Details for d2hl9a_

PDB Entry: 2hl9 (more details), 1.9 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfonic acid
PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOPe Domain Sequences for d2hl9a_:

Sequence, based on SEQRES records: (download)

>d2hl9a_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmkyi
ekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiid
lkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcg
iyvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records): (download)

>d2hl9a_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slvpelnekdddqvqkalasrentqlmnrieitvrdfktlaprrwlndtiieffmkyiek
stpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidlk
kktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgiy
vcmntlygsadapldfdykdairmrrfiahliltdalk

SCOPe Domain Coordinates for d2hl9a_:

Click to download the PDB-style file with coordinates for d2hl9a_.
(The format of our PDB-style files is described here.)

Timeline for d2hl9a_: