SCOPe 2.03: Domain d2hl9a_: 2hl9 A:

Lineage for d2hl9a_ (2hl9 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Ulp1 protease C-terminal domain [54057] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)

8. Domain d2hl9a_: 2hl9 A: [147308]
   automated match to d1euva_

Details for d2hl9a_

PDB Entry: 2hl9, 1.9 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfonic acid

PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOPe Domain Sequences for d2hl9a_:

Sequence, based on SEQRES records:

>d2hl9a_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmkyi
ekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiid
lkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcg
iyvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records):

>d2hl9a_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slvpelnekdddqvqkalasrentqlmnrieitvrdfktlaprrwlndtiieffmkyiek
stpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidlk
kktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgiy
vcmntlygsadapldfdykdairmrrfiahliltdalk

Timeline for d2hl9a_:

• d2hl9a_ first appeared in SCOP 1.75, called d2hl9a1
  
• d2hl9a_ appears in SCOPe 2.02
  
• d2hl9a_ appears in SCOPe 2.04
  
• d2hl9a_ appears in the current release, SCOPe 2.08, called d2hl9a2