Lineage for d2hkva1 (2hkv A:1-147)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780470Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order
  4. 780471Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) (S)
    contains metal-binding site on the bundle surface surrounded by loops
  5. 780479Family a.213.1.2: DinB-like [140603] (4 proteins)
    Pfam PF05163
  6. 780491Protein Hypothetical protein ExigDRAFT_2445 [158517] (1 species)
  7. 780492Species Exiguobacterium sibiricum 255-15 [TaxId:262543] [158518] (1 PDB entry)
    Uniprot Q41IB9 1-147
  8. 780493Domain d2hkva1: 2hkv A:1-147 [147306]
    complexed with cl, ni

Details for d2hkva1

PDB Entry: 2hkv (more details), 1.7 Å

PDB Description: crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2hkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkva1 a.213.1.2 (A:1-147) Hypothetical protein ExigDRAFT_2445 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}
mtdwqqaldrhvgvgvrttrdlirliqpedwdkrpisgkrsvyevavhlavlleadlria
tgatademaqfyavpvlpeqlvdrldqswqyyqdrlmadfstettywgvtdsttgwllea
avhlyhhrsqlldylnllgydikldlf

SCOP Domain Coordinates for d2hkva1:

Click to download the PDB-style file with coordinates for d2hkva1.
(The format of our PDB-style files is described here.)

Timeline for d2hkva1: