SCOPe 2.08: Domain d2hkva1: 2hkv A:1-147

Lineage for d2hkva1 (2hkv A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.2: DinB-like [140603] (4 proteins)
   Pfam PF05163

6. Protein Hypothetical protein ExigDRAFT_2445 [158517] (1 species)

7. Species Exiguobacterium sibiricum 255-15 [TaxId:262543] [158518] (1 PDB entry)
   Uniprot Q41IB9 1-147

8. Domain d2hkva1: 2hkv A:1-147 [147306]
   Other proteins in same PDB: d2hkva2
   complexed with cl, ni

Details for d2hkva1

PDB Entry: 2hkv, 1.7 Å

PDB Description: crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hkva1:

Sequence; same for both SEQRES and ATOM records:

>d2hkva1 a.213.1.2 (A:1-147) Hypothetical protein ExigDRAFT_2445 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}
mtdwqqaldrhvgvgvrttrdlirliqpedwdkrpisgkrsvyevavhlavlleadlria
tgatademaqfyavpvlpeqlvdrldqswqyyqdrlmadfstettywgvtdsttgwllea
avhlyhhrsqlldylnllgydikldlf

Timeline for d2hkva1:

• d2hkva1 first appeared in SCOP 1.75
  
• d2hkva1 appears in SCOPe 2.07