Lineage for d2hkub1 (2hku B:19-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692414Protein Putative transcriptional regulator RHA1_ro03468 [158252] (1 species)
  7. 2692415Species Rhodococcus sp. RHA1 [TaxId:101510] [158253] (1 PDB entry)
    Uniprot Q0SB15 18-87
  8. 2692417Domain d2hkub1: 2hku B:19-87 [147304]
    Other proteins in same PDB: d2hkua2, d2hkub2
    automated match to d2hkua1
    complexed with edo, pg4

Details for d2hkub1

PDB Entry: 2hku (more details), 2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator from Rhodococcus sp. RHA1
PDB Compounds: (B:) A putative transcriptional regulator

SCOPe Domain Sequences for d2hkub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkub1 a.4.1.9 (B:19-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}
trdalftaatelflehgegvpitqicaaagahpnqvtyyygskerlfvevacaavlragk
raeddaata

SCOPe Domain Coordinates for d2hkub1:

Click to download the PDB-style file with coordinates for d2hkub1.
(The format of our PDB-style files is described here.)

Timeline for d2hkub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hkub2