SCOPe 2.08: Domain d2hkub1: 2hku B:19-87

Lineage for d2hkub1 (2hku B:19-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator RHA1_ro03468 [158252] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158253] (1 PDB entry)
   Uniprot Q0SB15 18-87

8. Domain d2hkub1: 2hku B:19-87 [147304]
   Other proteins in same PDB: d2hkua2, d2hkub2
   automated match to d2hkua1
   complexed with edo, pg4

Details for d2hkub1

PDB Entry: 2hku, 2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator from Rhodococcus sp. RHA1

PDB Compounds: (B:) A putative transcriptional regulator

SCOPe Domain Sequences for d2hkub1:

Sequence; same for both SEQRES and ATOM records:

>d2hkub1 a.4.1.9 (B:19-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}
trdalftaatelflehgegvpitqicaaagahpnqvtyyygskerlfvevacaavlragk
raeddaata

Timeline for d2hkub1:

• d2hkub1 first appeared in SCOP 1.75
  
• d2hkub1 appears in SCOPe 2.07