Lineage for d2hkua2 (2hku A:88-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728088Protein Putative transcriptional regulator RHA1_ro03468 [158806] (1 species)
  7. 2728089Species Rhodococcus sp. RHA1 [TaxId:101510] [158807] (1 PDB entry)
    Uniprot Q0SB15 88-208
  8. 2728090Domain d2hkua2: 2hku A:88-208 [147303]
    Other proteins in same PDB: d2hkua1, d2hkub1
    complexed with edo, pg4

Details for d2hkua2

PDB Entry: 2hku (more details), 2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator from Rhodococcus sp. RHA1
PDB Compounds: (A:) A putative transcriptional regulator

SCOPe Domain Sequences for d2hkua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkua2 a.121.1.1 (A:88-208) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}
etvgdyteklvgsllgpgapsvelftsamlmtgrrselrdlitdtlrtlhssgevalirt
lmrtgwqlragidveskafwsaifglviqktatgesfgysleeavavifanlqipetvrn
t

SCOPe Domain Coordinates for d2hkua2:

Click to download the PDB-style file with coordinates for d2hkua2.
(The format of our PDB-style files is described here.)

Timeline for d2hkua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hkua1