SCOPe 2.08: Domain d2hkua2: 2hku A:88-208

Lineage for d2hkua2 (2hku A:88-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Putative transcriptional regulator RHA1_ro03468 [158806] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158807] (1 PDB entry)
   Uniprot Q0SB15 88-208

8. Domain d2hkua2: 2hku A:88-208 [147303]
   Other proteins in same PDB: d2hkua1, d2hkub1
   complexed with edo, pg4

Details for d2hkua2

PDB Entry: 2hku, 2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator from Rhodococcus sp. RHA1

PDB Compounds: (A:) A putative transcriptional regulator

SCOPe Domain Sequences for d2hkua2:

Sequence; same for both SEQRES and ATOM records:

>d2hkua2 a.121.1.1 (A:88-208) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}
etvgdyteklvgsllgpgapsvelftsamlmtgrrselrdlitdtlrtlhssgevalirt
lmrtgwqlragidveskafwsaifglviqktatgesfgysleeavavifanlqipetvrn
t

Timeline for d2hkua2:

• d2hkua2 first appeared in SCOP 1.75
  
• d2hkua2 appears in SCOPe 2.07