![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Putative transcriptional regulator RHA1_ro03468 [158806] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [158807] (1 PDB entry) Uniprot Q0SB15 88-208 |
![]() | Domain d2hkua2: 2hku A:88-208 [147303] Other proteins in same PDB: d2hkua1, d2hkub1 complexed with edo, pg4 |
PDB Entry: 2hku (more details), 2 Å
SCOPe Domain Sequences for d2hkua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hkua2 a.121.1.1 (A:88-208) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} etvgdyteklvgsllgpgapsvelftsamlmtgrrselrdlitdtlrtlhssgevalirt lmrtgwqlragidveskafwsaifglviqktatgesfgysleeavavifanlqipetvrn t
Timeline for d2hkua2: