SCOPe 2.05: Domain d2hkua1: 2hku A:18-87

Lineage for d2hkua1 (2hku A:18-87)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator RHA1_ro03468 [158252] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158253] (1 PDB entry)
   Uniprot Q0SB15 18-87

8. Domain d2hkua1: 2hku A:18-87 [147302]
   Other proteins in same PDB: d2hkua2, d2hkub2
   complexed with edo, pg4

Details for d2hkua1

PDB Entry: 2hku, 2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator from Rhodococcus sp. RHA1

PDB Compounds: (A:) A putative transcriptional regulator

SCOPe Domain Sequences for d2hkua1:

Sequence; same for both SEQRES and ATOM records:

>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}
qtrdalftaatelflehgegvpitqicaaagahpnqvtyyygskerlfvevacaavlrag
kraeddaata

Timeline for d2hkua1:

• d2hkua1 first appeared in SCOP 1.75
  
• d2hkua1 appears in SCOPe 2.04
  
• d2hkua1 appears in SCOPe 2.06
  
• d2hkua1 appears in the current release, SCOPe 2.08