Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative transcriptional regulator RHA1_ro03468 [158252] (1 species) |
Species Rhodococcus sp. RHA1 [TaxId:101510] [158253] (1 PDB entry) Uniprot Q0SB15 18-87 |
Domain d2hkua1: 2hku A:18-87 [147302] Other proteins in same PDB: d2hkua2, d2hkub2 complexed with edo, pg4 |
PDB Entry: 2hku (more details), 2 Å
SCOPe Domain Sequences for d2hkua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} qtrdalftaatelflehgegvpitqicaaagahpnqvtyyygskerlfvevacaavlrag kraeddaata
Timeline for d2hkua1: