Lineage for d2hkpa_ (2hkp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015342Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1015374Protein Ulp1 protease C-terminal domain [54057] (1 species)
  7. 1015375Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54058] (4 PDB entries)
  8. 1015379Domain d2hkpa_: 2hkp A: [147301]
    automated match to d1euva_

Details for d2hkpa_

PDB Entry: 2hkp (more details), 2.1 Å

PDB Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid
PDB Compounds: (A:) Ubiquitin-like-specific protease 1

SCOPe Domain Sequences for d2hkpa_:

Sequence, based on SEQRES records: (download)

>d2hkpa_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
giyvcmntlygsadapldfdykdairmrrfiahliltdalk

Sequence, based on observed residues (ATOM records): (download)

>d2hkpa_ d.3.1.7 (A:) Ulp1 protease C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gslvpelnekdddqvqkalasrtqlmnrdnieitvrdfktlaprrwlndtiieffmkyie
kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
yvcmntlygsadapldfdykdairmrrfiahliltdalk

SCOPe Domain Coordinates for d2hkpa_:

Click to download the PDB-style file with coordinates for d2hkpa_.
(The format of our PDB-style files is described here.)

Timeline for d2hkpa_: