SCOPe 2.08: Domain d2hkac_: 2hka C:

Lineage for d2hkac_ (2hka C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (3 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
   a cholesterol binding protein

7. Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries)

8. Domain d2hkac_: 2hka C: [147300]
   automated match to d1nepa_
   complexed with act, c3s, gol, nag, so4

Details for d2hkac_

PDB Entry: 2hka, 1.81 Å

PDB Description: crystal structure of bovine npc2 and cholesterol sulfate complex

PDB Compounds: (C:) Epididymal secretory protein E1

SCOPe Domain Sequences for d2hkac_:

Sequence; same for both SEQRES and ATOM records:

>d2hkac_ b.1.18.7 (C:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

Timeline for d2hkac_:

• d2hkac_ first appeared in SCOP 1.75, called d2hkac1
  
• d2hkac_ appears in SCOPe 2.07