Lineage for d2hkab1 (2hka B:1-130)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789390Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
  6. 789391Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
    a cholesterol binding protein
  7. 789392Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries)
  8. 789395Domain d2hkab1: 2hka B:1-130 [147299]
    automatically matched to d1nepa_
    complexed with act, c3s, gol, nag, so4

Details for d2hkab1

PDB Entry: 2hka (more details), 1.81 Å

PDB Description: crystal structure of bovine npc2 and cholesterol sulfate complex
PDB Compounds: (B:) Epididymal secretory protein E1

SCOP Domain Sequences for d2hkab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkab1 b.1.18.7 (B:1-130) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

SCOP Domain Coordinates for d2hkab1:

Click to download the PDB-style file with coordinates for d2hkab1.
(The format of our PDB-style files is described here.)

Timeline for d2hkab1: