SCOP 1.75: Domain d2hkaa1: 2hka A:1-130

Lineage for d2hkaa1 (2hka A:1-130)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (2 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products

6. Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
   a cholesterol binding protein

7. Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries)

8. Domain d2hkaa1: 2hka A:1-130 [147298]
   automatically matched to d1nepa_
   complexed with act, c3s, gol, nag, so4

Details for d2hkaa1

PDB Entry: 2hka, 1.81 Å

PDB Description: crystal structure of bovine npc2 and cholesterol sulfate complex

PDB Compounds: (A:) Epididymal secretory protein E1

SCOP Domain Sequences for d2hkaa1:

Sequence; same for both SEQRES and ATOM records:

>d2hkaa1 b.1.18.7 (A:1-130) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

Timeline for d2hkaa1:

• d2hkaa1 is new in SCOP 1.75
  
• d2hkaa1 is called d2hkaa_ in SCOPe 2.01
  
• d2hkaa1 appears in the current release, SCOPe 2.08, called d2hkaa_