Lineage for d2hjja1 (2hjj A:10-75)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190745Superfamily d.50.3: YcfA/nrd intein domain [54786] (3 families) (S)
  5. 2190754Family d.50.3.3: YkfF-like [160203] (1 protein)
    Pfam PF06006; DUF905
  6. 2190755Protein Hypothetical protein YkfF [160204] (1 species)
  7. 2190756Species Escherichia coli [TaxId:562] [160205] (1 PDB entry)
    Uniprot P75677 10-75
  8. 2190757Domain d2hjja1: 2hjj A:10-75 [147295]

Details for d2hjja1

PDB Entry: 2hjj (more details)

PDB Description: Solution NMR structure of protein ykfF from Escherichia coli. Northeast Structural Genomics target ER397.
PDB Compounds: (A:) Hypothetical protein ykfF

SCOPe Domain Sequences for d2hjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjja1 d.50.3.3 (A:10-75) Hypothetical protein YkfF {Escherichia coli [TaxId: 562]}
gpftrrqaqavtttysnitleddqgshfrlvvrdtegrmvwrawnfepdageglnryirt
sgirtd

SCOPe Domain Coordinates for d2hjja1:

Click to download the PDB-style file with coordinates for d2hjja1.
(The format of our PDB-style files is described here.)

Timeline for d2hjja1: