Lineage for d2hjea_ (2hje A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038349Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 1038385Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
    Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like
  6. 1038386Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (1 species)
  7. 1038387Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
    Uniprot P54302 51-271! Uniprot P54302 52-270
  8. 1038388Domain d2hjea_: 2hje A: [147294]
    automated match to d1zhhb1
    complexed with ni

Details for d2hjea_

PDB Entry: 2hje (more details), 1.7 Å

PDB Description: Crystal structure of Vibrio harveyi LuxQ periplasmic domain
PDB Compounds: (A:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOPe Domain Sequences for d2hjea_:

Sequence, based on SEQRES records: (download)

>d2hjea_ d.110.6.3 (A:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqrkssdkrldkllvietpivvnavttelclltvqd

Sequence, based on observed residues (ATOM records): (download)

>d2hjea_ d.110.6.3 (A:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqllvietpivvnavttelclltvqd

SCOPe Domain Coordinates for d2hjea_:

Click to download the PDB-style file with coordinates for d2hjea_.
(The format of our PDB-style files is described here.)

Timeline for d2hjea_: