Lineage for d2hjea1 (2hje A:52-270)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870954Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 870987Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
    Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like
  6. 870988Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (1 species)
  7. 870989Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
    Uniprot P54302 51-271! Uniprot P54302 52-270
  8. 870990Domain d2hjea1: 2hje A:52-270 [147294]
    automatically matched to 2HJ9 C:52-270
    complexed with ni

Details for d2hjea1

PDB Entry: 2hje (more details), 1.7 Å

PDB Description: Crystal structure of Vibrio harveyi LuxQ periplasmic domain
PDB Compounds: (A:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOP Domain Sequences for d2hjea1:

Sequence, based on SEQRES records: (download)

>d2hjea1 d.110.6.3 (A:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqrkssdkrldkllvietpivvnavttelclltvq

Sequence, based on observed residues (ATOM records): (download)

>d2hjea1 d.110.6.3 (A:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqllvietpivvnavttelclltvq

SCOP Domain Coordinates for d2hjea1:

Click to download the PDB-style file with coordinates for d2hjea1.
(The format of our PDB-style files is described here.)

Timeline for d2hjea1: