SCOPe 2.08: Domain d2hj1b2: 2hj1 B:11-89

Lineage for d2hj1b2 (2hj1 B:11-89)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.4: HI0395-like [159931] (2 proteins)
   Pfam PF03658; UPF0125

6. Protein automated matches [190686] (1 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:281310] [187814] (1 PDB entry)

8. Domain d2hj1b2: 2hj1 B:11-89 [147293]
   Other proteins in same PDB: d2hj1a1, d2hj1b3
   automated match to d2hj1a1
   complexed with so4

Details for d2hj1b2

PDB Entry: 2hj1, 2.1 Å

PDB Description: crystal structure of a 3d domain-swapped dimer of protein hi0395 from haemophilus influenzae

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2hj1b2:

Sequence; same for both SEQRES and ATOM records:

>d2hj1b2 d.15.3.4 (B:11-89) automated matches {Haemophilus influenzae [TaxId: 281310]}
nqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnkigifsrpikl
tdvlkegdrieiyrpllad

Timeline for d2hj1b2:

• d2hj1b2 first appeared in SCOP 1.75, called d2hj1b1
  
• d2hj1b2 appears in SCOPe 2.07