![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.3.4: HI0395-like [159931] (2 proteins) Pfam PF03658; UPF0125 |
![]() | Protein Hypothetical protein HI0395 [159932] (1 species) NTHI0516 |
![]() | Species Haemophilus influenzae [TaxId:727] [159933] (1 PDB entry) Uniprot Q4QNE7 2-78 |
![]() | Domain d2hj1a1: 2hj1 A:11-87 [147292] Other proteins in same PDB: d2hj1b2, d2hj1b3 complexed with so4 |
PDB Entry: 2hj1 (more details), 2.1 Å
SCOPe Domain Sequences for d2hj1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} nqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnkigifsrpikl tdvlkegdrieiyrpll
Timeline for d2hj1a1: