SCOPe 2.08: Domain d2hiyc2: 2hiy C:1-180

Lineage for d2hiyc2 (2hiy C:1-180)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.356: SP0830-like [160378] (1 superfamily)
   duplication: two beta-alpha-beta(2)-alpha-beta-alpha motifs are organized in ferredoxin-like subdomains swapped with the extra C-terminal helices

4. Superfamily d.356.1: SP0830-like [160379] (1 family)

5. Family d.356.1.1: SP0830-like [160380] (1 protein)
   Pfam PF08002; DUF1697

6. Protein Hypothetical protein SP0830 [160381] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160382] (1 PDB entry)
   Uniprot Q97RI5 1-180

8. Domain d2hiyc2: 2hiy C:1-180 [147290]
   Other proteins in same PDB: d2hiya2, d2hiyb3, d2hiyc3, d2hiyd3
   automated match to d2hiya1
   complexed with cl, gol, mg

Details for d2hiyc2

PDB Entry: 2hiy, 1.4 Å

PDB Description: The structure of conserved bacterial protein SP0830 from Streptococcus pneumoniae. (CASP Target)

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2hiyc2:

Sequence; same for both SEQRES and ATOM records:

>d2hiyc2 d.356.1.1 (C:1-180) Hypothetical protein SP0830 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtryallvrginvggknkvvmaelrqeltnlglekvesyinsgnifftsidskaqlvekl
etffavhypfiqsfsllsledfeaelenlpawwsrdlarkdflfytegldvdqviatves
lelkdevlyfgklgifwgkfseesysktayhkyllkvpfyrhitirnaktfdkigqmlkk

Timeline for d2hiyc2:

• d2hiyc2 first appeared in SCOP 1.75, called d2hiyc1
  
• d2hiyc2 appears in SCOPe 2.07