![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.356: SP0830-like [160378] (1 superfamily) duplication: two beta-alpha-beta(2)-alpha-beta-alpha motifs are organized in ferredoxin-like subdomains swapped with the extra C-terminal helices |
![]() | Superfamily d.356.1: SP0830-like [160379] (1 family) ![]() |
![]() | Family d.356.1.1: SP0830-like [160380] (1 protein) Pfam PF08002; DUF1697 |
![]() | Protein Hypothetical protein SP0830 [160381] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160382] (1 PDB entry) Uniprot Q97RI5 1-180 |
![]() | Domain d2hiyb2: 2hiy B:1-179 [147289] Other proteins in same PDB: d2hiya2, d2hiyb3, d2hiyc3, d2hiyd3 automated match to d2hiya1 complexed with cl, gol, mg |
PDB Entry: 2hiy (more details), 1.4 Å
SCOPe Domain Sequences for d2hiyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hiyb2 d.356.1.1 (B:1-179) Hypothetical protein SP0830 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mtryallvrginvggknkvvmaelrqeltnlglekvesyinsgnifftsidskaqlvekl etffavhypfiqsfsllsledfeaelenlpawwsrdlarkdflfytegldvdqviatves lelkdevlyfgklgifwgkfseesysktayhkyllkvpfyrhitirnaktfdkigqmlk
Timeline for d2hiyb2: