Lineage for d2hiya1 (2hiy A:1-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011487Fold d.356: SP0830-like [160378] (1 superfamily)
    duplication: two beta-alpha-beta(2)-alpha-beta-alpha motifs are organized in ferredoxin-like subdomains swapped with the extra C-terminal helices
  4. 3011488Superfamily d.356.1: SP0830-like [160379] (1 family) (S)
  5. 3011489Family d.356.1.1: SP0830-like [160380] (1 protein)
    Pfam PF08002; DUF1697
  6. 3011490Protein Hypothetical protein SP0830 [160381] (1 species)
  7. 3011491Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160382] (1 PDB entry)
    Uniprot Q97RI5 1-180
  8. 3011492Domain d2hiya1: 2hiy A:1-180 [147288]
    Other proteins in same PDB: d2hiya2, d2hiyb3, d2hiyc3, d2hiyd3
    complexed with cl, gol, mg

Details for d2hiya1

PDB Entry: 2hiy (more details), 1.4 Å

PDB Description: The structure of conserved bacterial protein SP0830 from Streptococcus pneumoniae. (CASP Target)
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hiya1:

Sequence, based on SEQRES records: (download)

>d2hiya1 d.356.1.1 (A:1-180) Hypothetical protein SP0830 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtryallvrginvggknkvvmaelrqeltnlglekvesyinsgnifftsidskaqlvekl
etffavhypfiqsfsllsledfeaelenlpawwsrdlarkdflfytegldvdqviatves
lelkdevlyfgklgifwgkfseesysktayhkyllkvpfyrhitirnaktfdkigqmlkk

Sequence, based on observed residues (ATOM records): (download)

>d2hiya1 d.356.1.1 (A:1-180) Hypothetical protein SP0830 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtryallvrginvgknkvvmaelrqeltnlglekvesyinsgnifftsidskaqlvekle
tffavhypfiqsfsllsledfeaelenlpawwsrdlarkdflfytegldvdqviatvesl
elkdevlyfgklgifwgkfseesysktayhkyllkvpfyrhitirnaktfdkigqmlkk

SCOPe Domain Coordinates for d2hiya1:

Click to download the PDB-style file with coordinates for d2hiya1.
(The format of our PDB-style files is described here.)

Timeline for d2hiya1: