Lineage for d2hi5a1 (2hi5 A:6-47)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039819Species Bacteriophage fd [TaxId:10864] [57990] (7 PDB entries)
  8. 3039824Domain d2hi5a1: 2hi5 A:6-47 [147287]
    automatically matched to d1fdma_

Details for d2hi5a1

PDB Entry: 2hi5 (more details), 8 Å

PDB Description: model for bacteriophage fd from cryo-em
PDB Compounds: (A:) coat protein b

SCOPe Domain Sequences for d2hi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hi5a1 h.1.4.1 (A:6-47) Inovirus (filamentous phage) major coat protein {Bacteriophage fd [TaxId: 10864]}
pakaafdslqasateyigyawamvvvivgatigiklfkkfts

SCOPe Domain Coordinates for d2hi5a1:

Click to download the PDB-style file with coordinates for d2hi5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hi5a1: