Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage fd [TaxId:10864] [57990] (7 PDB entries) |
Domain d2hi5a1: 2hi5 A:6-47 [147287] automatically matched to d1fdma_ |
PDB Entry: 2hi5 (more details), 8 Å
SCOPe Domain Sequences for d2hi5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hi5a1 h.1.4.1 (A:6-47) Inovirus (filamentous phage) major coat protein {Bacteriophage fd [TaxId: 10864]} pakaafdslqasateyigyawamvvvivgatigiklfkkfts
Timeline for d2hi5a1: