Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.358: YdfO-like [160418] (1 superfamily) duplication: two alpha(2)-beta(3) motifs are related by pseudo twofold symmetry; single antiparrallel beta-sheet, order:321456 |
Superfamily d.358.1: YdfO-like [160419] (1 family) |
Family d.358.1.1: YdfO-like [160420] (1 protein) Pfam PF07166; DUF1398 |
Protein Hypothetical protein YdfO [160421] (1 species) |
Species Escherichia coli [TaxId:562] [160422] (1 PDB entry) Uniprot P76156 2-128 |
Domain d2hh8a1: 2hh8 A:7-133 [147286] |
PDB Entry: 2hh8 (more details)
SCOP Domain Sequences for d2hh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hh8a1 d.358.1.1 (A:7-133) Hypothetical protein YdfO {Escherichia coli [TaxId: 562]} dqvvifkqifdkvrndlnyqwfyselkrhnvshyiyylatenvhivlkndntvllkglkn ivsvkfskdrhliettsnklksreitfqeyrrnlakagvfrwvtniheqkryyytfdnsl lftesiq
Timeline for d2hh8a1: