Lineage for d2hh6a1 (2hh6 A:1-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717741Superfamily a.69.4: BH3980-like [158560] (1 family) (S)
    automatically mapped to Pfam PF06304
  5. 2717742Family a.69.4.1: BH3980-like [158561] (3 proteins)
    Pfam PF06304; DUF1048
  6. 2717750Protein Uncharacterized protein BH3980 [158564] (1 species)
  7. 2717751Species Bacillus halodurans [TaxId:86665] [158565] (1 PDB entry)
    Uniprot Q9K5V7 1-112
  8. 2717752Domain d2hh6a1: 2hh6 A:1-112 [147285]

Details for d2hh6a1

PDB Entry: 2hh6 (more details), 2.04 Å

PDB Description: crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution
PDB Compounds: (A:) BH3980 protein

SCOPe Domain Sequences for d2hh6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hh6a1 a.69.4.1 (A:1-112) Uncharacterized protein BH3980 {Bacillus halodurans [TaxId: 86665]}
msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifgg
ildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd

SCOPe Domain Coordinates for d2hh6a1:

Click to download the PDB-style file with coordinates for d2hh6a1.
(The format of our PDB-style files is described here.)

Timeline for d2hh6a1: