![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.4: BH3980-like [158560] (1 family) ![]() automatically mapped to Pfam PF06304 |
![]() | Family a.69.4.1: BH3980-like [158561] (3 proteins) Pfam PF06304; DUF1048 |
![]() | Protein Uncharacterized protein BH3980 [158564] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [158565] (1 PDB entry) Uniprot Q9K5V7 1-112 |
![]() | Domain d2hh6a1: 2hh6 A:1-112 [147285] |
PDB Entry: 2hh6 (more details), 2.04 Å
SCOPe Domain Sequences for d2hh6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hh6a1 a.69.4.1 (A:1-112) Uncharacterized protein BH3980 {Bacillus halodurans [TaxId: 86665]} msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifgg ildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd
Timeline for d2hh6a1: