Lineage for d2hgka1 (2hgk A:1-109)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913365Superfamily a.29.17: YqcC-like [158452] (1 family) (S)
  5. 913366Family a.29.17.1: YqcC-like [158453] (1 protein)
    Pfam PF04287; DUF446
  6. 913367Protein Hypothetical protein YqcC [158454] (1 species)
  7. 913368Species Escherichia coli [TaxId:562] [158455] (1 PDB entry)
    Uniprot Q46919 1-109
  8. 913369Domain d2hgka1: 2hgk A:1-109 [147284]

Details for d2hgka1

PDB Entry: 2hgk (more details)

PDB Description: solution nmr structure of protein yqcc from e. coli: northeast structural genomics consortium target er225
PDB Compounds: (A:) Hypothetical protein yqcC

SCOPe Domain Sequences for d2hgka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgka1 a.29.17.1 (A:1-109) Hypothetical protein YqcC {Escherichia coli [TaxId: 562]}
mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh
dlldnkqplpgafavapyyemalatdhpqralilaelekldalfaddas

SCOPe Domain Coordinates for d2hgka1:

Click to download the PDB-style file with coordinates for d2hgka1.
(The format of our PDB-style files is described here.)

Timeline for d2hgka1: