SCOPe 2.08: Domain d2hgka1: 2hgk A:1-109

Lineage for d2hgka1 (2hgk A:1-109)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.17: YqcC-like [158452] (1 family)
   automatically mapped to Pfam PF04287

5. Family a.29.17.1: YqcC-like [158453] (1 protein)
   Pfam PF04287; DUF446

6. Protein Hypothetical protein YqcC [158454] (1 species)

7. Species Escherichia coli [TaxId:562] [158455] (1 PDB entry)
   Uniprot Q46919 1-109

8. Domain d2hgka1: 2hgk A:1-109 [147284]
   Other proteins in same PDB: d2hgka2

Details for d2hgka1

PDB Entry: 2hgk

PDB Description: solution nmr structure of protein yqcc from e. coli: northeast structural genomics consortium target er225

PDB Compounds: (A:) Hypothetical protein yqcC

SCOPe Domain Sequences for d2hgka1:

Sequence; same for both SEQRES and ATOM records:

>d2hgka1 a.29.17.1 (A:1-109) Hypothetical protein YqcC {Escherichia coli [TaxId: 562]}
mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh
dlldnkqplpgafavapyyemalatdhpqralilaelekldalfaddas

Timeline for d2hgka1:

• d2hgka1 first appeared in SCOP 1.75
  
• d2hgka1 appears in SCOPe 2.07