Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.17: YqcC-like [158452] (1 family) automatically mapped to Pfam PF04287 |
Family a.29.17.1: YqcC-like [158453] (1 protein) Pfam PF04287; DUF446 |
Protein Hypothetical protein YqcC [158454] (1 species) |
Species Escherichia coli [TaxId:562] [158455] (1 PDB entry) Uniprot Q46919 1-109 |
Domain d2hgka1: 2hgk A:1-109 [147284] Other proteins in same PDB: d2hgka2 |
PDB Entry: 2hgk (more details)
SCOPe Domain Sequences for d2hgka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgka1 a.29.17.1 (A:1-109) Hypothetical protein YqcC {Escherichia coli [TaxId: 562]} mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh dlldnkqplpgafavapyyemalatdhpqralilaelekldalfaddas
Timeline for d2hgka1: