Lineage for d2hgca1 (2hgc A:5-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694456Family a.4.5.77: YjcQ-like [158317] (1 protein)
    Pfam PF09639
  6. 2694457Protein Uncharacterized protein YjcQ [158318] (1 species)
  7. 2694458Species Bacillus subtilis [TaxId:1423] [158319] (1 PDB entry)
    Uniprot O31639 5-82
  8. 2694459Domain d2hgca1: 2hgc A:5-82 [147283]

Details for d2hgca1

PDB Entry: 2hgc (more details)

PDB Description: solution nmr structure of the yjcq protein from bacillus subtilis. northeast structural genomics target sr346.
PDB Compounds: (A:) YjcQ protein

SCOPe Domain Sequences for d2hgca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgca1 a.4.5.77 (A:5-82) Uncharacterized protein YjcQ {Bacillus subtilis [TaxId: 1423]}
klryailkeifegntplsendigvtedqfddavnflkregyiigvhysddrphlyklgpe
ltekgenylkengtwska

SCOPe Domain Coordinates for d2hgca1:

Click to download the PDB-style file with coordinates for d2hgca1.
(The format of our PDB-style files is described here.)

Timeline for d2hgca1: