Lineage for d2hg7a1 (2hg7 A:1-60)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005534Fold d.186: gpW/XkdW-like [64209] (2 superfamilies)
    alpha-beta(2)-alpha; antiparallel hairpin
  4. 3005542Superfamily d.186.2: XkdW-like [159865] (1 family) (S)
    different packing of secondary structures than in gpW
  5. 3005543Family d.186.2.1: XkdW-like [159866] (1 protein)
    Pfam PF09636
  6. 3005544Protein Phage-like element PbsX protein XkdW [159867] (1 species)
  7. 3005545Species Bacillus subtilis [TaxId:1423] [159868] (1 PDB entry)
    Uniprot P54342 1-60
  8. 3005546Domain d2hg7a1: 2hg7 A:1-60 [147281]

Details for d2hg7a1

PDB Entry: 2hg7 (more details)

PDB Description: solution nmr structure of phage-like element pbsx protein xkdw, northeast structural genomics consortium target sr355
PDB Compounds: (A:) Phage-like element PBSX protein xkdW

SCOPe Domain Sequences for d2hg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg7a1 d.186.2.1 (A:1-60) Phage-like element PbsX protein XkdW {Bacillus subtilis [TaxId: 1423]}
milydaimykypnavsrkdfelrndgngsyiekwnlraplptqaeletwweelqknppye

SCOPe Domain Coordinates for d2hg7a1:

Click to download the PDB-style file with coordinates for d2hg7a1.
(The format of our PDB-style files is described here.)

Timeline for d2hg7a1: