![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.364: PA1123-like [160476] (1 superfamily) irregular array of short helices and two three-stranded beta-sheets |
![]() | Superfamily d.364.1: PA1123-like [160477] (1 family) ![]() automatically mapped to Pfam PF09634 |
![]() | Family d.364.1.1: PA1123-like [160478] (1 protein) Pfam PF09634; DUF2025 |
![]() | Protein Hypothetical protein PA1123 [160479] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160480] (1 PDB entry) Uniprot Q9I4L2 1-106 |
![]() | Domain d2hg6a1: 2hg6 A:1-106 [147280] |
PDB Entry: 2hg6 (more details)
SCOPe Domain Sequences for d2hg6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg6a1 d.364.1.1 (A:1-106) Hypothetical protein PA1123 {Pseudomonas aeruginosa [TaxId: 287]} msitstdicqaadalkgfvgfnrktgryivrfsedsfgmdvaddsitptsefvwssvrdd vmrlgreqlqilleqninerlnigepllvylrrqdlpeitaqrqlr
Timeline for d2hg6a1: