Lineage for d2hg6a1 (2hg6 A:1-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011608Fold d.364: PA1123-like [160476] (1 superfamily)
    irregular array of short helices and two three-stranded beta-sheets
  4. 3011609Superfamily d.364.1: PA1123-like [160477] (1 family) (S)
    automatically mapped to Pfam PF09634
  5. 3011610Family d.364.1.1: PA1123-like [160478] (1 protein)
    Pfam PF09634; DUF2025
  6. 3011611Protein Hypothetical protein PA1123 [160479] (1 species)
  7. 3011612Species Pseudomonas aeruginosa [TaxId:287] [160480] (1 PDB entry)
    Uniprot Q9I4L2 1-106
  8. 3011613Domain d2hg6a1: 2hg6 A:1-106 [147280]

Details for d2hg6a1

PDB Entry: 2hg6 (more details)

PDB Description: solution nmr structure of protein pa1123 from pseudomonas aeruginosa. northeast structural genomics consortium target pat4; ontario centre for structural proteomics target pa1123.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hg6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg6a1 d.364.1.1 (A:1-106) Hypothetical protein PA1123 {Pseudomonas aeruginosa [TaxId: 287]}
msitstdicqaadalkgfvgfnrktgryivrfsedsfgmdvaddsitptsefvwssvrdd
vmrlgreqlqilleqninerlnigepllvylrrqdlpeitaqrqlr

SCOPe Domain Coordinates for d2hg6a1:

Click to download the PDB-style file with coordinates for d2hg6a1.
(The format of our PDB-style files is described here.)

Timeline for d2hg6a1: