Lineage for d2hf7b_ (2hf7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527298Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2527299Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2527300Species Escherichia coli [TaxId:562] [102309] (13 PDB entries)
    Uniprot P32697 27-237
  8. 2527312Domain d2hf7b_: 2hf7 B: [147277]
    automated match to d1rmta_
    complexed with af3, mg

Details for d2hf7b_

PDB Entry: 2hf7 (more details), 1.6 Å

PDB Description: Transition State Analogue of AphA class B Acid Phosphatase/Phosphotransferase (Aluminium Fluoride Complex)
PDB Compounds: (B:) Class B acid phosphatase

SCOPe Domain Sequences for d2hf7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hf7b_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d2hf7b_:

Click to download the PDB-style file with coordinates for d2hf7b_.
(The format of our PDB-style files is described here.)

Timeline for d2hf7b_: