Lineage for d2hf7a1 (2hf7 A:3-212)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848223Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 848224Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 848225Species Escherichia coli [TaxId:562] [102309] (10 PDB entries)
    Uniprot P32697 27-237
  8. 848234Domain d2hf7a1: 2hf7 A:3-212 [147276]
    automatically matched to d1rmta_
    complexed with af3, mg

Details for d2hf7a1

PDB Entry: 2hf7 (more details), 1.6 Å

PDB Description: Transition State Analogue of AphA class B Acid Phosphatase/Phosphotransferase (Aluminium Fluoride Complex)
PDB Compounds: (A:) Class B acid phosphatase

SCOP Domain Sequences for d2hf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hf7a1 c.108.1.12 (A:3-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
psplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkkt
fspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetv
sktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgarg
irilrasnstykplpqagafgeevivnsey

SCOP Domain Coordinates for d2hf7a1:

Click to download the PDB-style file with coordinates for d2hf7a1.
(The format of our PDB-style files is described here.)

Timeline for d2hf7a1: