Lineage for d2hf5a1 (2hf5 A:81-113)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269440Protein Troponin C [47503] (6 species)
  7. 1269475Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (19 PDB entries)
  8. 1269489Domain d2hf5a1: 2hf5 A:81-113 [147275]
    automatically matched to d1ctaa_
    complexed with ca

Details for d2hf5a1

PDB Entry: 2hf5 (more details)

PDB Description: the structure and function of a novel two-site calcium-binding fragment of calmodulin
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2hf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
seeeireafrvfdkdgngyisaaelrhvmtnlg

SCOPe Domain Coordinates for d2hf5a1:

Click to download the PDB-style file with coordinates for d2hf5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hf5a1: