Lineage for d2heqa1 (2heq A:1-71)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947647Superfamily b.34.20: YorP-like [159038] (1 family) (S)
  5. 947648Family b.34.20.1: YorP-like [159039] (1 protein)
    Pfam PF09629
  6. 947649Protein Uncharacterized protein YorP [159040] (1 species)
  7. 947650Species Bacillus subtilis [TaxId:1423] [159041] (1 PDB entry)
    Uniprot O31898 1-71
  8. 947651Domain d2heqa1: 2heq A:1-71 [147272]

Details for d2heqa1

PDB Entry: 2heq (more details)

PDB Description: nmr structure of bacillus subtilis protein yorp, northeast structural genomics target sr399.
PDB Compounds: (A:) YorP protein

SCOPe Domain Sequences for d2heqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heqa1 b.34.20.1 (A:1-71) Uncharacterized protein YorP {Bacillus subtilis [TaxId: 1423]}
magdplpkywsypvglaveinnnarygcphhvgrkgkiiehlhsatydyavsdetgdity
fkeheltplkg

SCOPe Domain Coordinates for d2heqa1:

Click to download the PDB-style file with coordinates for d2heqa1.
(The format of our PDB-style files is described here.)

Timeline for d2heqa1: