Lineage for d2hepa1 (2hep A:1-42)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980694Superfamily a.2.21: YnzC-like [158221] (1 family) (S)
  5. 1980695Family a.2.21.1: YznC-like [158222] (2 proteins)
    Pfam PF05979; DUF896
  6. 1980696Protein Hypothetical protein YnzC [158223] (1 species)
  7. 1980697Species Bacillus subtilis [TaxId:1423] [158224] (1 PDB entry)
    Uniprot O31818 1-42
  8. 1980698Domain d2hepa1: 2hep A:1-42 [147271]

Details for d2hepa1

PDB Entry: 2hep (more details)

PDB Description: solution nmr structure of the upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384.
PDB Compounds: (A:) UPF0291 protein ynzC

SCOPe Domain Sequences for d2hepa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hepa1 a.2.21.1 (A:1-42) Hypothetical protein YnzC {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfr

SCOPe Domain Coordinates for d2hepa1:

Click to download the PDB-style file with coordinates for d2hepa1.
(The format of our PDB-style files is described here.)

Timeline for d2hepa1: