SCOP 1.75: Domain d2hegb1: 2heg B:3-212

Lineage for d2hegb1 (2heg B:3-212)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (10 PDB entries)
   Uniprot P32697 27-237

8. Domain d2hegb1: 2heg B:3-212 [147270]
   automatically matched to d1rmta_
   complexed with bfd, mg

Details for d2hegb1

PDB Entry: 2heg, 1.5 Å

PDB Description: Phospho-Aspartyl Intermediate Analogue of Apha class B acid phosphatase/phosphotransferase

PDB Compounds: (B:) Class B acid phosphatase

SCOP Domain Sequences for d2hegb1:

Sequence; same for both SEQRES and ATOM records:

>d2hegb1 c.108.1.12 (B:3-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
psplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkkt
fspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetv
sktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgarg
irilrasnstykplpqagafgeevivnsey

Timeline for d2hegb1:

• d2hegb1 is new in SCOP 1.75
  
• d2hegb1 is called d2hegb_ in SCOPe 2.01
  
• d2hegb1 appears in the current release, SCOPe 2.08, called d2hegb_