Lineage for d2hegb1 (2heg B:3-212)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848223Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 848224Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 848225Species Escherichia coli [TaxId:562] [102309] (10 PDB entries)
    Uniprot P32697 27-237
  8. 848233Domain d2hegb1: 2heg B:3-212 [147270]
    automatically matched to d1rmta_
    complexed with bfd, mg

Details for d2hegb1

PDB Entry: 2heg (more details), 1.5 Å

PDB Description: Phospho-Aspartyl Intermediate Analogue of Apha class B acid phosphatase/phosphotransferase
PDB Compounds: (B:) Class B acid phosphatase

SCOP Domain Sequences for d2hegb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hegb1 c.108.1.12 (B:3-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
psplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkkt
fspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetv
sktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgarg
irilrasnstykplpqagafgeevivnsey

SCOP Domain Coordinates for d2hegb1:

Click to download the PDB-style file with coordinates for d2hegb1.
(The format of our PDB-style files is described here.)

Timeline for d2hegb1: