![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin automatically mapped to Pfam PF03767 |
![]() | Protein Class B acid phosphatase, AphA [102308] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102309] (13 PDB entries) Uniprot P32697 27-237 |
![]() | Domain d2hegb_: 2heg B: [147270] automated match to d1rmta_ complexed with mg |
PDB Entry: 2heg (more details), 1.5 Å
SCOPe Domain Sequences for d2hegb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hegb_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar girilrasnstykplpqagafgeevivnsey
Timeline for d2hegb_: