SCOPe 2.02: Domain d2hega_: 2heg A:

Lineage for d2hega_ (2heg A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (11 PDB entries)
   Uniprot P32697 27-237

8. Domain d2hega_: 2heg A: [147269]
   automated match to d1rmta_
   complexed with mg

Details for d2hega_

PDB Entry: 2heg, 1.5 Å

PDB Description: Phospho-Aspartyl Intermediate Analogue of Apha class B acid phosphatase/phosphotransferase

PDB Compounds: (A:) Class B acid phosphatase

SCOPe Domain Sequences for d2hega_:

Sequence; same for both SEQRES and ATOM records:

>d2hega_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

Timeline for d2hega_:

• d2hega_ first appeared in SCOP 1.75, called d2hega1
  
• d2hega_ appears in SCOPe 2.01
  
• d2hega_ appears in SCOPe 2.03
  
• d2hega_ appears in the current release, SCOPe 2.08