![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (13 families) ![]() |
![]() | Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins) Pfam PF01878; DUF55 |
![]() | Protein Hypothetical protein PH1033 [141706] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries) Uniprot O58764 1-145 |
![]() | Domain d2hd9a1: 2hd9 A:1-145 [147268] complexed with ca, cit, gol |
PDB Entry: 2hd9 (more details), 1.35 Å
SCOP Domain Sequences for d2hd9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hd9a1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]} mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw smhffgkamrelpeedyklieklll
Timeline for d2hd9a1: