Lineage for d2hd9a1 (2hd9 A:1-145)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813274Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins)
    Pfam PF01878; DUF55
  6. 813281Protein Hypothetical protein PH1033 [141706] (1 species)
  7. 813282Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries)
    Uniprot O58764 1-145
  8. 813283Domain d2hd9a1: 2hd9 A:1-145 [147268]
    complexed with ca, cit, gol

Details for d2hd9a1

PDB Entry: 2hd9 (more details), 1.35 Å

PDB Description: Crystal structure of PH1033 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) UPF0310 protein PH1033

SCOP Domain Sequences for d2hd9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hd9a1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
smhffgkamrelpeedyklieklll

SCOP Domain Coordinates for d2hd9a1:

Click to download the PDB-style file with coordinates for d2hd9a1.
(The format of our PDB-style files is described here.)

Timeline for d2hd9a1: