SCOPe 2.08: Domain d2hd3h2: 2hd3 H:1-95

Lineage for d2hd3h2 (2hd3 H:1-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (2 families)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
   Pfam PF03319

6. Protein Ethanolamine utilization protein EutN [159135] (1 species)

7. Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
   Uniprot P0AEJ9 1-95

8. Domain d2hd3h2: 2hd3 H:1-95 [147263]
   Other proteins in same PDB: d2hd3a2, d2hd3b3, d2hd3c3, d2hd3d3, d2hd3e3, d2hd3g3, d2hd3h3, d2hd3i3, d2hd3j3, d2hd3l3
   automated match to d2hd3a1

Details for d2hd3h2

PDB Entry: 2hd3, 2.4 Å

PDB Description: crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316

PDB Compounds: (H:) Ethanolamine utilization protein eutN

SCOPe Domain Sequences for d2hd3h2:

Sequence; same for both SEQRES and ATOM records:

>d2hd3h2 b.40.15.1 (H:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhk

Timeline for d2hd3h2:

• d2hd3h2 first appeared in SCOP 1.75, called d2hd3h1
  
• d2hd3h2 appears in SCOPe 2.07