Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein Ethanolamine utilization protein EutN [159135] (1 species) |
Species Escherichia coli [TaxId:562] [159136] (2 PDB entries) Uniprot P0AEJ9 1-95 |
Domain d2hd3g2: 2hd3 G:1-95 [147262] Other proteins in same PDB: d2hd3a2, d2hd3b3, d2hd3c3, d2hd3d3, d2hd3e3, d2hd3g3, d2hd3h3, d2hd3i3, d2hd3j3, d2hd3l3 automated match to d2hd3a1 |
PDB Entry: 2hd3 (more details), 2.4 Å
SCOPe Domain Sequences for d2hd3g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hd3g2 b.40.15.1 (G:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]} mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg ssarqahksetspvdlcvigivdevvsggqvifhk
Timeline for d2hd3g2: