Lineage for d2hd3c1 (2hd3 C:1-95)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 800617Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 800618Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
    Pfam PF03319
  6. 800638Protein Ethanolamine utilization protein EutN [159135] (1 species)
  7. 800639Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
    Uniprot P0AEJ9 1-95
  8. 800642Domain d2hd3c1: 2hd3 C:1-95 [147258]
    automatically matched to 2HD3 A:1-95

Details for d2hd3c1

PDB Entry: 2hd3 (more details), 2.4 Å

PDB Description: crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
PDB Compounds: (C:) Ethanolamine utilization protein eutN

SCOP Domain Sequences for d2hd3c1:

Sequence, based on SEQRES records: (download)

>d2hd3c1 b.40.15.1 (C:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhk

Sequence, based on observed residues (ATOM records): (download)

>d2hd3c1 b.40.15.1 (C:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
svdlcvigivdevvsggqvifhk

SCOP Domain Coordinates for d2hd3c1:

Click to download the PDB-style file with coordinates for d2hd3c1.
(The format of our PDB-style files is described here.)

Timeline for d2hd3c1: