![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.352: FlaG-like [160213] (1 superfamily) alpha(2)-beta(3)-alpha; 2 layers: a/b; antiparallel beta-sheet, order: 123; partial similatity to the dsRBD-like fold(sop_cf 54767) |
![]() | Superfamily d.352.1: FlaG-like [160214] (1 family) ![]() automatically mapped to Pfam PF03646 |
![]() | Family d.352.1.1: FlaG-like [160215] (1 protein) Pfam PF03646 |
![]() | Protein Hypothetical protein YvyC [160216] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160217] (1 PDB entry) Uniprot P39737 1-109 |
![]() | Domain d2hc5a1: 2hc5 A:2-109 [147255] Other proteins in same PDB: d2hc5a2, d2hc5a3 |
PDB Entry: 2hc5 (more details)
SCOPe Domain Sequences for d2hc5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hc5a1 d.352.1.1 (A:2-109) Hypothetical protein YvyC {Bacillus subtilis [TaxId: 1423]} nierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkfe lhdklneyyvkviedstnevireippkrwldfyaamteflglfvdekk
Timeline for d2hc5a1: