Lineage for d2hc5a1 (2hc5 A:2-109)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011437Fold d.352: FlaG-like [160213] (1 superfamily)
    alpha(2)-beta(3)-alpha; 2 layers: a/b; antiparallel beta-sheet, order: 123; partial similatity to the dsRBD-like fold(sop_cf 54767)
  4. 3011438Superfamily d.352.1: FlaG-like [160214] (1 family) (S)
    automatically mapped to Pfam PF03646
  5. 3011439Family d.352.1.1: FlaG-like [160215] (1 protein)
    Pfam PF03646
  6. 3011440Protein Hypothetical protein YvyC [160216] (1 species)
  7. 3011441Species Bacillus subtilis [TaxId:1423] [160217] (1 PDB entry)
    Uniprot P39737 1-109
  8. 3011442Domain d2hc5a1: 2hc5 A:2-109 [147255]
    Other proteins in same PDB: d2hc5a2, d2hc5a3

Details for d2hc5a1

PDB Entry: 2hc5 (more details)

PDB Description: solution nmr structure of protein yvyc from bacillus subtilis. northeast structural genomics consortium target sr482.
PDB Compounds: (A:) Hypothetical protein yvyC

SCOPe Domain Sequences for d2hc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hc5a1 d.352.1.1 (A:2-109) Hypothetical protein YvyC {Bacillus subtilis [TaxId: 1423]}
nierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkfe
lhdklneyyvkviedstnevireippkrwldfyaamteflglfvdekk

SCOPe Domain Coordinates for d2hc5a1:

Click to download the PDB-style file with coordinates for d2hc5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hc5a1: