Lineage for d2hbab1 (2hba B:1-52)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663358Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1663359Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1663360Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 1663361Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 1663362Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries)
  8. 1663364Domain d2hbab1: 2hba B:1-52 [147254]
    automatically matched to 2HBA A:1-52
    complexed with cl, imd, zn

Details for d2hbab1

PDB Entry: 2hba (more details), 1.25 Å

PDB Description: crystal structure of n-terminal domain of ribosomal protein l9 (ntl9) k12m
PDB Compounds: (B:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2hbab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbab1 d.100.1.1 (B:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq

SCOPe Domain Coordinates for d2hbab1:

Click to download the PDB-style file with coordinates for d2hbab1.
(The format of our PDB-style files is described here.)

Timeline for d2hbab1: