Lineage for d2h9fa1 (2h9f A:1-182)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898817Family d.21.1.4: PA0793-like [160123] (1 protein)
    Pfam PF04303; DUF453
  6. 1898818Protein Hypothetical protein PA0793 [160124] (1 species)
  7. 1898819Species Pseudomonas aeruginosa [TaxId:287] [160125] (1 PDB entry)
    Uniprot Q9I5E5 1-182! Uniprot Q9I5E5 187-395
  8. 1898820Domain d2h9fa1: 2h9f A:1-182 [147248]
    complexed with cl, co, gol, so4

Details for d2h9fa1

PDB Entry: 2h9f (more details), 1.95 Å

PDB Description: crystal structure of a prpf family methylaconitate isomerase (pa0793) from pseudomonas aeruginosa at 1.95 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2h9fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9fa1 d.21.1.4 (A:1-182) Hypothetical protein PA0793 {Pseudomonas aeruginosa [TaxId: 287]}
mahppqiripatylrggtskgvffrledlpescrvpgeardrlfmrvigspdpyaahidg
mggatsstskcvilskssqpghdvdylygqvsidkpfvdwsgncgnlstgagafalhagl
vdparipedgicevriwqanigktiiahvpvsggqvqetgdfeldgvtfpaaeivlefld
ps

SCOPe Domain Coordinates for d2h9fa1:

Click to download the PDB-style file with coordinates for d2h9fa1.
(The format of our PDB-style files is described here.)

Timeline for d2h9fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h9fa2