Lineage for d2h94a3 (2h94 A:655-763)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1639904Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1639905Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1640115Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1640139Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 1640140Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries)
    Uniprot O60341 655-763
  8. 1640148Domain d2h94a3: 2h94 A:655-763 [147247]
    Other proteins in same PDB: d2h94a1, d2h94a2
    automatically matched to 2IW5 A:655-763
    complexed with fad, hg

Details for d2h94a3

PDB Entry: 2h94 (more details), 2.9 Å

PDB Description: crystal structure and mechanism of human lysine-specific demethylase-1
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2h94a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h94a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOPe Domain Coordinates for d2h94a3:

Click to download the PDB-style file with coordinates for d2h94a3.
(The format of our PDB-style files is described here.)

Timeline for d2h94a3: