SCOPe 2.03: Domain d2h94a1: 2h94 A:172-273

Lineage for d2h94a1 (2h94 A:172-273)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (3 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
   Uniprot O60341 169-279

8. Domain d2h94a1: 2h94 A:172-273 [147245]
   Other proteins in same PDB: d2h94a2, d2h94a3
   automatically matched to 2IW5 A:171-273
   complexed with fad, hg

Details for d2h94a1

PDB Entry: 2h94, 2.9 Å

PDB Description: crystal structure and mechanism of human lysine-specific demethylase-1

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2h94a1:

Sequence; same for both SEQRES and ATOM records:

>d2h94a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d2h94a1:

• d2h94a1 first appeared in SCOP 1.75
  
• d2h94a1 appears in SCOPe 2.02
  
• d2h94a1 appears in SCOPe 2.04
  
• d2h94a1 appears in the current release, SCOPe 2.08