Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) |
Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries) Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70 |
Domain d2h8wa2: 2h8w A:2-68 [147244] Other proteins in same PDB: d2h8wa1 automatically matched to 2HGJ L:2-68 |
PDB Entry: 2h8w (more details)
SCOPe Domain Sequences for d2h8wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8wa2 d.47.1.1 (A:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya drsftfv
Timeline for d2h8wa2: