| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries) Uniprot P36238 70-139! Uniprot P36238 71-137 |
| Domain d2h8wa1: 2h8w A:70-139 [147243] Other proteins in same PDB: d2h8wa2 automatically matched to 2HGJ L:70-139 |
PDB Entry: 2h8w (more details)
SCOPe Domain Sequences for d2h8wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8wa1 a.4.7.1 (A:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag
sarsmgvevv
Timeline for d2h8wa1: