Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (2 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56156] (7 PDB entries) |
Domain d2h8ha3: 2h8h A:249-529 [147242] Other proteins in same PDB: d2h8ha1, d2h8ha2 automatically matched to d1kswa3 complexed with h8h |
PDB Entry: 2h8h (more details), 2.2 Å
SCOPe Domain Sequences for d2h8ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8ha3 d.144.1.7 (A:249-529) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp eslhdlmcqcwrkepeerptfeylqafledyftstepqyqp
Timeline for d2h8ha3: